PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01153.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 74aa    MW: 8411.34 Da    PI: 10.6112
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01153.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.61.6e-192870347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     ++T+eEd  +++a++ +G++ W+tIar ++ gRt++ +k++w++ 
        PK01153.2 28 PFTPEEDSMIIQAHAAHGNK-WATIARLLP-GRTDNAIKNHWNST 70
                     89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.88E-23872IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-8933IPR009057Homeodomain-like
PROSITE profilePS5129423.182174IPR017930Myb domain
SMARTSM007172.1E-142573IPR001005SANT/Myb domain
CDDcd001671.04E-132871No hitNo description
PfamPF002497.8E-172870IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-233471IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
XRVRPSYGGK SCRLRWCNQL CPSVQHRPFT PEEDSMIIQA HAAHGNKWAT IARLLPGRTD  60
NAIKNHWNST LQIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2497239102MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008369404.12e-38PREDICTED: transcription factor MYB23-like
SwissprotQ9FDW17e-33MYB44_ARATH; Transcription factor MYB44
TrEMBLB9SQP62e-37B9SQP6_RICCO; R2r3-myb transcription factor, putative
STRINGPOPTR_0008s07100.13e-36(Populus trichocarpa)
STRINGGLYMA14G06320.22e-36(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF116002935
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-35myb domain protein 77